PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi000348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family EIL
Protein Properties Length: 389aa    MW: 43826.5 Da    PI: 5.6857
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-21962PU_refplantGDBView CDS
gnl|UG|Psi#S26069965PU_unrefUnigeneView CDS
gnl|UG|Psi#S26074239PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3430.81.3e-131463611308
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                +el+k+mwkd+++l+r+ke++k ++    +  +++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+LraWWkekv+
  Psi000348  46 DELEKQMWKDRIRLRRIKEQRKGKY----H-SDTAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVR 140
                79********************987....2.467799*************************************************************** PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fdrngpaai+kyqa+++ ++ ++s+ +    ++h+l+elqDTtlgSLLsalmqhcdppqrr+pl kg   P   + +e+ww++lgl+k qg+ppykkphd
  Psi000348 141 FDRNGPAAIAKYQAEHATPGANESNMV-VAPTPHTLQELQDTTLGSLLSALMQHCDPPQRRYPLGKGYFSPLVANYNEDWWPQLGLPKGQGPPPYKKPHD 239
                ******************998877755.9******************************************99999************************ PP

                --HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX...XXXXXXXXXXXXXXXXXXXX.XXXXXX.XX CS
       EIN3 201 lkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss...slrkqspkvtlsceqkedve.gkkeskikh 294
                lkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+v+nqee+++++  ++  ++     ++++ ++t+s+++++dve  +++++ + 
  Psi000348 240 LKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAVVNQEEALARQKNPNacPPisaAESTHAGSMTFSSSSEYDVEgFEDDPN-SI 338
                ***********************************************************999976335434444999*************6333333.32 PP

                XXXXXXXX.........XXXXXX CS
       EIN3 295 vqavktta.........gfpvvr 308
                  +++ ++         + +v++
  Psi000348 339 YTNNDVQDckpqdldllNSEVQE 361
                22222222333335555444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.7E-12046293No hitNo description
Gene3DG3DSA:1.10.3180.102.4E-66167302IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.31E-54172297IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGIYDEMGYP GNLDLLSVPL EGDSMCENEG EVMHDEGLSE DDIDVDELEK QMWKDRIRLR  60
RIKEQRKGKY HSDTAKQRQS QEQARRKKMS RAQDGILKYM LKMMEVCKAQ GFVYGIIPEK  120
GKPVSGASDN LRAWWKEKVR FDRNGPAAIA KYQAEHATPG ANESNMVVAP TPHTLQELQD  180
TTLGSLLSAL MQHCDPPQRR YPLGKGYFSP LVANYNEDWW PQLGLPKGQG PPPYKKPHDL  240
KKAWKVGVLT AVIKHMSPDI AKIRKLVRQS KCLQDKMTAK ESATWLAVVN QEEALARQKN  300
PNACPPISAA ESTHAGSMTF SSSSEYDVEG FEDDPNSIYT NNDVQDCKPQ DLDLLNSEVQ  360
ECKPQEFDHF NIGISNEGVS ALQDNVDFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-751713032134Protein ETHYLENE INSENSITIVE 3
4zds_B1e-751713032134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011629273.10.0PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246061e-169EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0C9RQ590.0A0A0C9RQ59_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_3637_3249 transcribed RNA sequence
STRINGVIT_13s0047g00250.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-156EIL family protein